General Information

  • ID:  hor005290
  • Uniprot ID:  P11967
  • Protein name:  Pancreatic hormone
  • Gene name:  PPY
  • Organism:  Struthio camelus (Common ostrich)
  • Family:  NPY family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Struthio (genus), Struthionidae (family), Struthioniformes (order), Palaeognathae (superorder), Aves (class), Coelurosauria, Theropoda, Saurischia, Dinosauria, Archosauria, Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GPAQPTYPGDDAPVEDLVRFYDNLQQYLNVVTRHRY
  • Length:  36(1-36)
  • Propeptide:  GPAQPTYPGDDAPVEDLVRFYDNLQQYLNVVTRHRY
  • Signal peptide:  NA
  • Modification:  T36 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Acts as a regulator of pancreatic and gastrointestinal functions
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P11967-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P11967-F1.pdbhor005290_AF2.pdbhor005290_ESM.pdb

Physical Information

Mass: 483309 Formula: C189H280N52O58
Absent amino acids: CIKMSW Common amino acids: DPVY
pI: 4.59 Basic residues: 4
Polar residues: 10 Hydrophobic residues: 10
Hydrophobicity: -85.83 Boman Index: -8731
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 70.28
Instability Index: 6874.17 Extinction Coefficient cystines: 5960
Absorbance 280nm: 170.29

Literature

  • PubMed ID:  3623804
  • Title:  Purification and primary structure of ostrich pancreatic polypeptide.